DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and CG7829

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster


Alignment Length:247 Identity:103/247 - (41%)
Similarity:138/247 - (55%) Gaps:11/247 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ILLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQ-RSYHFCGGSLIAQGWVLTAAHCTEG 85
            :||:..| |......|.|.|||||..|:|.:|||.||:| ...|.||||:|....:|||.||..|
  Fly     9 LLLLQAS-GCLSLESRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLNG 72

  Fly    86 SAILLSKVRI-GSSRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVT--QAFVGL 147
            ....|.||:: |:||....|:|..:..:..|..|:..|:|:|..::.|    .||:|  :....:
  Fly    73 VPHRLLKVKVGGTSRYRKDGELFSVADLQVHENFNPKTMDYDIGIIRL----TKNLTLSRKVKAI 133

  Fly   148 PEQDADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPE 212
            |.....:|:||...::|||........|..||...||.|:||.|....|.  ::||||||||..:
  Fly   134 PINPERVAEGTYATIAGWGFKSMNGPPSDSLRYARVPIVNQTACRNLLGK--TVTDRMLCAGYLK 196

  Fly   213 GGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWISSV 264
            ||.||||.||||||:....|.|:||||.|||..:.||||||:.|:..|:..|
  Fly   197 GGTDACQMDSGGPLSVREQLVGIVSWGVGCALADKPGVYSRLDALHPWLDQV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 95/223 (43%)
Tryp_SPc 42..264 CDD:238113 95/225 (42%)
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 95/222 (43%)
Tryp_SPc 28..248 CDD:238113 95/225 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443124
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.