DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and intr

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster


Alignment Length:267 Identity:57/267 - (21%)
Similarity:91/267 - (34%) Gaps:77/267 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RRPRLDGRIVGG---QVANIKDIPYQVSL------------QRSYHF-----------CGGSLIA 72
            |.|::..|...|   :..:::.||.::..            :...||           |.|:||:
  Fly    55 RSPKISARFSSGGNKEPNSLEIIPAEIETLLTDGQATTEAPKAVKHFVMRILYENKVICSGALIS 119

  Fly    73 QGWVLTAAHCTEGSAILLSKVRIGSSRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSA 137
            ...|||:|.|                          ..|..|.|...:|.:....|.:    ||.
  Fly   120 TRLVLTSALC--------------------------FPRTLRQPPPRSYKLQASRSRI----YSV 154

  Fly   138 KN-VTQAFVGL-------PEQD-----ADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQT 189
            .| :|.|...:       |.:|     .|:.: :|:..:.......:|:....||:..:|   .:
  Fly   155 ANLITGAIEDMALLLLHAPLEDPFVHPIDLCE-SPLRRNDNVTMYMSQQHLRFLRTKLIP---NS 215

  Fly   190 QCTEAYGNFGS--ITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPG-VY 251
            .|..:|....:  ||..|||| |.......||...|..|.....|.||..:|..|:.....| :|
  Fly   216 NCKRSYAQDENAFITQTMLCA-LNSNRLVDCQTAKGDVLLHQDRLCGVDIYGQHCSDGGVNGELY 279

  Fly   252 SRVSAVR 258
            :.|...|
  Fly   280 ADVFKAR 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 55/260 (21%)
Tryp_SPc 42..264 CDD:238113 54/259 (21%)
intrNP_651633.1 Tryp_SPc 112..284 CDD:304450 48/206 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.