DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and CG34129

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster


Alignment Length:213 Identity:57/213 - (26%)
Similarity:91/213 - (42%) Gaps:34/213 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 CGGSLIAQGWVLTAAHCTEGSAILLSKVRIGSSRTSVGGQLV---GIKRVHRHPKFDAYTIDF-- 125
            ||.:..|...|:|:|:|            |...|.|:.|..|   ......|....|..||.|  
  Fly    68 CGAAYYAPLLVITSANC------------IYPYRNSLEGATVEGTAFSECDRENYADIDTIQFPE 120

  Fly   126 ---------DFSLLELEEYSAKNVTQAFVGLPEQDADIADGTPVLVSGWG--NTQSAQETSAVLR 179
                     |.:::.|.:.....:|: |:.|  ....:.....::|.|||  ||: .:..|:..|
  Fly   121 KFIYQKLYMDVAVVRLRDPVRGRLTE-FIRL--CSVKVQPKMQMVVFGWGFDNTE-VEIPSSDPR 181

  Fly   180 SVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCAR 244
            :|||..:|..:|.:.:.: ..|....:||..|:..|. |..|.|.||.....|.||||:|..|..
  Fly   182 NVTVTIISIKECRQKFKS-PKIASTSICARQPKNPKQ-CLYDGGSPLIYGRELCGVVSFGSHCID 244

  Fly   245 PNYPGVYSRVSAVRDWIS 262
            .:.||:|:.:..|:.:|:
  Fly   245 TSRPGMYTNIRRVKRFIT 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 56/210 (27%)
Tryp_SPc 42..264 CDD:238113 57/213 (27%)
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 56/210 (27%)
Tryp_SPc 55..261 CDD:304450 56/210 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.