DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and CG4053

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster


Alignment Length:248 Identity:77/248 - (31%)
Similarity:120/248 - (48%) Gaps:12/248 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ILLVNLSLGAT-----VRRPRLDGRIVGGQVANIKDIPYQVSLQRSY--HFCGGSLIAQGWVLTA 79
            :||:..|:..|     ..|..||.||||||.|.....|||||:|..:  |.|.|.::.:.|:|||
  Fly    10 LLLLGTSIDVTRGKRLDNRKLLDNRIVGGQEAEDGVAPYQVSIQTIWKTHICSGVILNEQWILTA 74

  Fly    80 AHCTEGSAILLSKVRIGSSRTSVGGQLVGIKRVHRHPKFD-AYTIDFDFSLLELEEYSAKNVTQA 143
            .||....:|...::.:|::.....||.:.......|..:| .|..:.|.:|:.:.|....|....
  Fly    75 GHCALDFSIEDLRIIVGTNDRLEPGQTLFPDEALVHCLYDIPYVYNNDIALIHVNESIIFNDRTQ 139

  Fly   144 FVGLPEQDADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCA 208
            .|.|..:....  |:.|.::|||..:|:..|...|:::.:..::..:|.|.:.....|....:|.
  Fly   140 IVELSREQPPA--GSTVTLTGWGAPESSYPTVQYLQTLNLTIIAHEECRERWDFHDGIDIGHICT 202

  Fly   209 GLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWI 261
            ...| |:.||.|||||||..:|.|.|:|:||..|. ...|.:|:.....:|||
  Fly   203 FTRE-GEGACSGDSGGPLMWEGKLVGLVNWGRACG-VGMPDMYANTVYYQDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 68/222 (31%)
Tryp_SPc 42..264 CDD:238113 69/223 (31%)
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 68/222 (31%)
Tryp_SPc 35..256 CDD:238113 69/223 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.