DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and CG17475

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:229 Identity:76/229 - (33%)
Similarity:117/229 - (51%) Gaps:7/229 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RIVGGQVANIKDIPYQVSLQRSY--HFCGGSLIAQGWVLTAAHCTEGSAILLSKVRIGSSRTSVG 103
            |::.|:...:.:..||:|||..|  |.|||.:|.:..|||||||..|......:|..|:......
  Fly    49 RVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYEKP 113

  Fly   104 GQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNT 168
            ..:..::....|..:::.....|.:|:.|.:....|.......||  .|.:|:||.:|::|||:|
  Fly   114 DAVYFVEEHWIHCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELP--TAPVANGTQLLLTGWGST 176

  Fly   169 QSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAADGVLW 233
            :...:|..:|:...:..|..:.|.|...|..|.....:|. |..||:.||.|||||||..:|||:
  Fly   177 ELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCHICT-LTTGGQGACHGDSGGPLTHNGVLY 240

  Fly   234 GVVSWGYGCARPNYPGVYSRVSAVRDWI-SSVSG 266
            |:|:|||.||. ..|..::.|....:|| |.:||
  Fly   241 GLVNWGYPCAL-GVPDSHANVYYYLEWIRSMISG 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 71/221 (32%)
Tryp_SPc 42..264 CDD:238113 73/224 (33%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 71/221 (32%)
Tryp_SPc 50..269 CDD:238113 72/222 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.