DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and CG17477

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:264 Identity:78/264 - (29%)
Similarity:123/264 - (46%) Gaps:20/264 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MAKTILHLFIGGILLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQR--SYHFCGGSLIA 72
            :|:.:.::.:...|..:|.        .|:..|||||.|...|.|||||||.  ..|.|||::|:
  Fly     3 LARFLFYILVFSSLYCDLL--------ALEHFIVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIIS 59

  Fly    73 QGWVLTAAHCTEGSAILLSKVRIGSSRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSA 137
            ..|::||.||.:|......:|..|:.|.:..|.:.....::.|..:|:.....|..||.|.|...
  Fly    60 DRWIITAGHCVKGYPTSRLQVATGTIRYAEPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESIT 124

  Fly   138 KNVTQAFVGLPEQDADIADGTPVLV-SGWGNTQSAQETSAVLRSVTVPKVSQTQC---TEAYGNF 198
            .|.....|.||  .:....|...|| :|||:..:|....:.|:.|....::...|   ..||.:.
  Fly   125 FNALTQAVELP--TSPFPRGASELVFTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDL 187

  Fly   199 GSITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWI-S 262
             .:....:|| ..:....||.|||||||...|.|.|::::...||: ..|.::..:...|||: .
  Fly   188 -ELGPCHICA-YRQANIGACHGDSGGPLVHQGTLVGILNFFVPCAQ-GVPDIFMNIMYYRDWMRQ 249

  Fly   263 SVSG 266
            ::||
  Fly   250 TMSG 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 71/225 (32%)
Tryp_SPc 42..264 CDD:238113 72/228 (32%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 72/227 (32%)
Tryp_SPc 27..246 CDD:214473 70/223 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.