DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and CG10405

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster


Alignment Length:256 Identity:100/256 - (39%)
Similarity:148/256 - (57%) Gaps:15/256 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LFIGGILLV---NLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQR-SYHFCGGSLIAQGWVL 77
            |.|.|||::   :.:..|..|:|  |.|||.|:.|.....|||:||:| :.|.||.|:::..|.:
  Fly    11 LLIAGILVILEASRTEAAVPRQP--DSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAI 73

  Fly    78 TAAHCTEGSAILLSK--VRIGSSRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEE--YSAK 138
            |||||.:|......:  :|.||...:.||.:..:|.:::||.:|...::||.:||...:  .|..
  Fly    74 TAAHCIDGHEQQPREFTLRQGSIMRTSGGTVQPVKAIYKHPAYDRADMNFDVALLRTADGALSLP 138

  Fly   139 NVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQET-SAVLRSVTVPKVSQTQCTEAYGNFGSIT 202
            ....|.:.||.....|::..|.:|||||:..::... |:||:|.||..|:|.:|.....:.|.:|
  Fly   139 LGKVAPIRLPTVGEAISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHGGVT 203

  Fly   203 DRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVS--AVRDWI 261
            :.|.||.  ....||||||||||::|.|.|.|:||||.|||.|.|||||:|::  .:|.||
  Fly   204 EAMFCAA--ARNTDACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 89/227 (39%)
Tryp_SPc 42..264 CDD:238113 90/228 (39%)
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 89/227 (39%)
Tryp_SPc 37..263 CDD:238113 90/228 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443120
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.