DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and CG16749

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:250 Identity:92/250 - (36%)
Similarity:136/250 - (54%) Gaps:27/250 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQRS--YHFCGGSLIAQGWVLTAAHCTEGSAIL 89
            :|.||    |:: ||:|.|..::::..|:.:|::.|  .|.||||:|::.:|:||||||:|....
  Fly    20 ISHGA----PQM-GRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGRKAS 79

  Fly    90 LSKVRIGSSR-TSVGGQLVGIKRVHRHPKFDAY-TIDFDFSLLELEE-YSAKNVTQAFVGLPEQD 151
            ...|:.|.:: .:.|..:|.:|::.:|..::.| ....|.|||.:|| :....||.|.|.|||  
  Fly    80 DLSVQYGVTKINATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPE-- 142

  Fly   152 ADIADGTP--------VLVSGWGNTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRM-LC 207
              :|..||        ||: |||...:.....:.|:.|.:...|..:|||.:|  |....|. :|
  Fly   143 --LAFATPQTDAGGEGVLI-GWGLNATGGYIQSTLQEVELKVYSDEECTERHG--GRTDPRYHIC 202

  Fly   208 AGLPEGGKDACQGDSGGPLAADGVLWGVVSWGY-GCARPNYPGVYSRVSAVRDWI 261
            .|:.||||..|.|||||||..:|...|:|||.. .|....|||||.:||...|||
  Fly   203 GGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 85/234 (36%)
Tryp_SPc 42..264 CDD:238113 85/234 (36%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 85/234 (36%)
Tryp_SPc 30..259 CDD:238113 85/234 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
44.020

Return to query results.
Submit another query.