DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Tmprss11c

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:245 Identity:93/245 - (37%)
Similarity:130/245 - (53%) Gaps:30/245 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RIVGGQVANIKDIPYQVSLQR-SYHFCGGSLIAQGWVLTAAHCTEGSA----------ILLSKVR 94
            ::.|||.|...:.|:|.|||: :.|.||.:||:..|::|||||...||          .||||.:
  Rat   186 KVAGGQDAEEGEWPWQASLQQNNVHRCGATLISNSWLITAAHCFVRSANPKDWKVSFGFLLSKPQ 250

  Fly    95 IGSSRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIADGTP 159
            ...:..|:        .:|.:..:.|:..|.....|........|:.:|.  |||........:.
  Rat   251 AQRAVKSI--------VIHENYSYPAHNNDIAVVRLSSPVLYENNIRRAC--LPEATQKFPPNSD 305

  Fly   160 VLVSGWGNTQSAQETSAVLRSVTVPKVSQTQCT--EAYGNFGSITDRMLCAGLPEGGKDACQGDS 222
            |:|:|||..:|..::..:|:...|..:....|.  :|||  |.||..|||||..||..|||||||
  Rat   306 VVVTGWGTLKSDGDSPNILQKGRVKIIDNKTCNSGKAYG--GVITPGMLCAGFLEGRVDACQGDS 368

  Fly   223 GGPLAAD---GV--LWGVVSWGYGCARPNYPGVYSRVSAVRDWISSVSGI 267
            ||||.::   |:  |.|:||||..||.||.||||:||:..||||||.:|:
  Rat   369 GGPLVSEDSKGIWFLAGIVSWGDECALPNKPGVYTRVTHYRDWISSKTGL 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 88/237 (37%)
Tryp_SPc 42..264 CDD:238113 91/239 (38%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699
Tryp_SPc 186..412 CDD:214473 88/237 (37%)
Tryp_SPc 187..415 CDD:238113 91/239 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.