DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Tryx5

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_006236430.1 Gene:Tryx5 / 408205 RGDID:1302947 Length:251 Species:Rattus norvegicus


Alignment Length:243 Identity:58/243 - (23%)
Similarity:87/243 - (35%) Gaps:62/243 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 DIPYQVSLQRSYHFCGGSLIAQGWVLTAAHCTEGSAILLSKVRIGSSRTSVGG---QLVGIKRVH 113
            ::||...|:.|...|.|:||...||||||||:     |.:|:|:|..|.::..   |:.|.....
  Rat    37 NVPYMAYLKSSPEPCVGTLIDPLWVLTAAHCS-----LPTKIRLGVYRPNIKNEKEQIHGYSLTV 96

  Fly   114 RHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSAVL 178
            .||.|||.....|..|::| .|.|             ..|:..||..:         |.|.....
  Rat    97 VHPNFDANIRKNDLMLIKL-SYPA-------------TIDMYVGTIAI---------AMEPMVFN 138

  Fly   179 RSVTVPKVSQTQCTEAYGNFG-------------SITD--------------RMLCAGLPEGGKD 216
            .:..:|    |.....|.|:.             |.:|              .::|.|.....|.
  Rat   139 ETCFIP----TWTWNHYNNYSDPDTLTWTNQYSRSPSDCWNTLHQQRQETRINIMCIGHSFNVKS 199

  Fly   217 ACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWISSV 264
            :.:..|..|....|.:.|::|||.........|.::.:.....||..|
  Rat   200 STKEVSAAPAICSGRVHGILSWGKAGITNGSEGFFTEIHPYARWILRV 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 55/238 (23%)
Tryp_SPc 42..264 CDD:238113 57/241 (24%)
Tryx5XP_006236430.1 Tryp_SPc 37..244 CDD:419748 55/238 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.