DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Prss58

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001009174.1 Gene:Prss58 / 408204 RGDID:1303054 Length:240 Species:Rattus norvegicus


Alignment Length:217 Identity:60/217 - (27%)
Similarity:100/217 - (46%) Gaps:14/217 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PYQVSLQRSYHFCGGSLIAQGWVLTAAHCTEGSAILLSKVRIGSSRTSVGGQLVGIKRVHRHPKF 118
            ||.|.|:..|..|.|.||...||:|:|||......::..:...:..|....::...:::.|||.|
  Rat    28 PYLVYLKSDYLPCTGVLIHPLWVVTSAHCNLPDLRVILGITNPADTTEHDVEVSDYEKMFRHPYF 92

  Fly   119 DAYTIDFDFSLLEL-----EEYSAKNVTQAFVGLPEQDADIADGTPVLVSGWG-NTQSAQETSAV 177
            ...:|.:|..|::|     ..|.||.|.     ||:....:  .....||.|. |.....:....
  Rat    93 SVSSISYDLMLIKLRRGIKHSYYAKAVK-----LPQHTVPV--NAMCSVSTWAYNLCDVTKEPDS 150

  Fly   178 LRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGC 242
            |::|.|..:|:.:|..||..| .|.:.|:|.|:..|.:..|:..:..|...:|||:|::|:..||
  Rat   151 LQTVNVSVISKAECHNAYKAF-DIRENMICVGIVPGRRLPCKEVTAAPAVCNGVLYGILSYADGC 214

  Fly   243 ARPNYPGVYSRVSAVRDWISSV 264
            ......|:|:.:.....||.::
  Rat   215 VLRADVGIYASIFHYMPWIENI 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 58/212 (27%)
Tryp_SPc 42..264 CDD:238113 60/215 (28%)
Prss58NP_001009174.1 Tryp_SPc 28..233 CDD:214473 58/212 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.