DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and CG10587

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001137989.2 Gene:CG10587 / 40318 FlyBaseID:FBgn0037039 Length:289 Species:Drosophila melanogaster


Alignment Length:257 Identity:86/257 - (33%)
Similarity:135/257 - (52%) Gaps:35/257 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LGATVRRPRLDGRIVGGQV-ANIKDIPYQVSLQRSYHF-CGGSLIAQGWVLTAAHCTEGSAILLS 91
            |...|:||....|:|||.| .|.:...|.::|:...:| |||:|:....|||||||      .|.
  Fly    33 LAKIVQRPGFQTRVVGGDVTTNAQLGGYLIALRYEMNFVCGGTLLHDLIVLTAAHC------FLG 91

  Fly    92 KVRI-------GSSRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEE-YSAKNVTQAFVGLP 148
            :|:|       |:|:.:..|....:|.|.:..:|....::.|.::|.|:: ...|::.|..:...
  Fly    92 RVKISDWLAVGGASKLNDRGIQRQVKEVIKSAEFREDDMNMDVAILRLKKPMKGKSLGQLILCKK 156

  Fly   149 EQDADIADGTPVLVSGWGNTQSAQ-ETSAVLRSVTVPKVSQTQCT--------EAYGNFG----- 199
            :    :..||.:.|||||.|:::: ....:||:||||.|.:.:|.        |::.:|.     
  Fly   157 Q----LMPGTELRVSGWGLTENSEFGPQKLLRTVTVPVVDKKKCRASYLPTDWESHKHFDLFLKV 217

  Fly   200 SITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWI 261
            .:||.|.|||: .|.||||..||||||.....:.|:||:|.|||...|.|||:.:..|:.:|
  Fly   218 HLTDSMFCAGV-LGKKDACTFDSGGPLVYKNQVCGIVSFGIGCASKRYYGVYTDIMYVKPFI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 81/243 (33%)
Tryp_SPc 42..264 CDD:238113 81/244 (33%)
CG10587NP_001137989.2 Tryp_SPc 45..278 CDD:214473 81/243 (33%)
Tryp_SPc 46..280 CDD:238113 81/244 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.