DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and CG11037

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_649272.1 Gene:CG11037 / 40317 FlyBaseID:FBgn0037038 Length:292 Species:Drosophila melanogaster


Alignment Length:232 Identity:81/232 - (34%)
Similarity:116/232 - (50%) Gaps:22/232 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RIVGGQV-ANIKDIPYQVSLQRSYHF-CGGSLIAQGWVLTAAHCTEGSAILLSKVRIGSSRTSVG 103
            |::||.| .|.|...|..:|.....| |||:|:.:..|||||||      .|.:::......:.|
  Fly    61 RVIGGHVTTNAKLGGYLTALLYEDDFVCGGTLLNENIVLTAAHC------FLGRMKASEWIVAAG 119

  Fly   104 GQLVGIKRVHRHPK-------FDAYTIDFDFSLLELE-EYSAKNVTQAFVGLPEQDADIADGTPV 160
            ...:..|.:.||.|       |....::.|.:::.|: ...|||:..    |......:..|..:
  Fly   120 ISNLNQKGIRRHVKDFILSEQFREDDMNMDVAVVLLKTPLKAKNIGT----LSLCSVSLKPGVEL 180

  Fly   161 LVSGWGNT-QSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGG 224
            :|||||.| ...:....:||:||||.:.:..|..||.....|||.|:||.: .|.||||..||||
  Fly   181 VVSGWGMTAPRGRGPHNLLRTVTVPIIHKKNCRAAYQPTAKITDSMICAAV-LGRKDACTFDSGG 244

  Fly   225 PLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWI 261
            ||.....:.|:||:|.|||...|||||:.|..|:.:|
  Fly   245 PLVFKKQVCGIVSFGIGCASNRYPGVYTDVMYVKPFI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 80/230 (35%)
Tryp_SPc 42..264 CDD:238113 80/231 (35%)
CG11037NP_649272.1 Tryp_SPc 61..281 CDD:214473 80/230 (35%)
Tryp_SPc 62..283 CDD:238113 80/231 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.