DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Sems

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster


Alignment Length:273 Identity:101/273 - (36%)
Similarity:139/273 - (50%) Gaps:24/273 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KTILHLF-IGGILLVN-----------LSLGATVRRPRLDGRIVGGQV-ANIKDIPYQVSLQRSY 63
            |.:|.|| :.|||:.|           ..|...|..|....|::||:| .|.|...|.|:::...
  Fly     2 KRLLFLFLLAGILINNHALQHNETIDLKKLAKIVLPPAYQTRVIGGRVTTNAKLGGYLVAMRYFN 66

  Fly    64 HF-CGGSLIAQGWVLTAAHCTEGSAILLS-KVRIGSSRTSVGGQLVGIKRVHRHPKFDAYTIDFD 126
            :| |||:||.:..|||||||.|..|...: .|..|.||.|..|....:||..:..:|...|::.|
  Fly    67 NFICGGTLIHELIVLTAAHCFEDRAEKEAWSVDGGISRLSEKGIRRQVKRFIKSAQFKMVTMNMD 131

  Fly   127 FSLLELEE-YSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQE-TSAVLRSVTVPKVSQT 189
            .:::.|.. ...||:..    |......:..|..:.|||||.|....| ...:||:|:||.:.:.
  Fly   132 VAVVLLNRPMVGKNIGT----LSLCSTALTPGQTMDVSGWGMTNPDDEGPGHMLRTVSVPVIEKR 192

  Fly   190 QCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRV 254
            .|.|||....||:|.|.||.: .|.||||..||||||..:..:.|:||:|.|||...|||||:.|
  Fly   193 ICREAYRESVSISDSMFCASV-LGKKDACTYDSGGPLVYEKQVCGIVSFGIGCASRRYPGVYTDV 256

  Fly   255 SAVRDWISSVSGI 267
            ..|:.:|  |.||
  Fly   257 HYVKPFI--VKGI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 86/224 (38%)
Tryp_SPc 42..264 CDD:238113 86/226 (38%)
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 86/224 (38%)
Tryp_SPc 44..265 CDD:238113 86/227 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.