DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and PRSS57

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_999875.2 Gene:PRSS57 / 400668 HGNCID:31397 Length:283 Species:Homo sapiens


Alignment Length:270 Identity:80/270 - (29%)
Similarity:113/270 - (41%) Gaps:21/270 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IGLTGMAKTILHLFIGGILLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQ-RSYHFCGG 68
            :||.|..:.:|.:....:|.|....|:      ...:|:||........||..|:: ...|.|||
Human     3 LGLRGWGRPLLTVATALMLPVKPPAGS------WGAQIIGGHEVTPHSRPYMASVRFGGQHHCGG 61

  Fly    69 SLIAQGWVLTAAHCTEGSAILLSKVRIGS---SRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLL 130
            .|:...||::||||.....:....|.:|:   |......|:.||..:..||.:...|...|..||
Human    62 FLLRARWVVSAAHCFSHRDLRTGLVVLGAHVLSTAEPTQQVFGIDALTTHPDYHPMTHANDICLL 126

  Fly   131 ELEEYSAKNVTQAFVGL---PEQDA-DIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQTQC 191
            .|   :...|....|||   |.:.| ....||...|:|||.....:|....|....|..:....|
Human   127 RL---NGSAVLGPAVGLLRPPGRRARPPTAGTRCRVAGWGFVSDFEELPPGLMEAKVRVLDPDVC 188

  Fly   192 TEAYGNFGSITDRMLCAGLPEGGKDA-CQGDSGGPLAADGVLWGVVSW-GYGCARPNYPGVYSRV 254
            ..::.  |.:|..|||....:..:.. |..||||||.......|:||: |..|..|..|.||::|
Human   189 NSSWK--GHLTLTMLCTRSGDSHRRGFCSADSGGPLVCRNRAHGLVSFSGLWCGDPKTPDVYTQV 251

  Fly   255 SAVRDWISSV 264
            ||...||..|
Human   252 SAFVAWIWDV 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 70/229 (31%)
Tryp_SPc 42..264 CDD:238113 72/231 (31%)
PRSS57NP_999875.2 Tryp_SPc 34..258 CDD:238113 70/228 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.