DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and CG32374

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster


Alignment Length:257 Identity:90/257 - (35%)
Similarity:128/257 - (49%) Gaps:19/257 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FIGGILLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQ-RSYHFCGGSLIAQGWVLTAAH 81
            |:.|.:..|.::.|...:..|..|||.|:.......|||.:|. .:|..||..::.:.|:|||.|
  Fly    50 FLPGNISTNPAINALEAQDYLPTRIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQH 114

  Fly    82 CTEGSAILLSKVRIGSSRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVG 146
            |..|:....: ||.||::...||||..:::...||.:..||:..|..:::|:       |...||
  Fly   115 CKIGNPGRYT-VRAGSTQQRRGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLK-------TPLNVG 171

  Fly   147 LPEQDADIADGTP------VLVSGWGNTQ-SAQETSAVLRSVTVPKVSQTQCTEAYGNFG-SITD 203
            ...|...:.....      .|.||||.|. :||.....||.|.|.|||:.:|.:.|...| .|..
  Fly   172 RCVQKVKLPSTRTKRFPKCYLASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYK 236

  Fly   204 RMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWISSVS 265
            :|:||  ....:|.|.|||||||..:|||:|:.|:|.|||...|||||..|.....||..|:
  Fly   237 QMICA--KRKNRDTCSGDSGGPLVHNGVLYGITSFGIGCASAKYPGVYVNVLQYTRWIKKVA 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 82/228 (36%)
Tryp_SPc 42..264 CDD:238113 83/230 (36%)
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 82/228 (36%)
Tryp_SPc 74..295 CDD:238113 83/230 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443111
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
65.850

Return to query results.
Submit another query.