DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and CG16998

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster


Alignment Length:227 Identity:82/227 - (36%)
Similarity:118/227 - (51%) Gaps:8/227 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RIVGGQVANIKDIPYQVSLQ-RSYHFCGGSLIAQGWVLTAAHCTEGSAILLSKVRIGSSRTSVGG 104
            |||||....|...|:..|:. ...:.|..:||...|::||.||.:.....  .||.||:.|..||
  Fly    24 RIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHCVQYPDSY--SVRAGSTFTDGGG 86

  Fly   105 QLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQ 169
            |...:..|..||.|:..|::.|.:||:|::..........|.||....:|...| :||:||||..
  Fly    87 QRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQVVKLPLPSLNILPRT-LLVAGWGNPD 150

  Fly   170 SA-QETSAVLRSVTVPKVSQTQCTEAYGNF-GSITDRMLCAGLPEGGKDACQGDSGGPLAADGVL 232
            :. .|:...||...|..::|..|...|.:. ..|||.|:||.  ..|:|.|.||||.||...|..
  Fly   151 ATDSESEPRLRGTVVKVINQRLCQRLYSHLHRPITDDMVCAA--GAGRDHCYGDSGAPLVHRGSS 213

  Fly   233 WGVVSWGYGCARPNYPGVYSRVSAVRDWISSV 264
            :|:||:.:|||.|::||||:|::....||.:|
  Fly   214 YGIVSFAHGCADPHFPGVYTRLANYVTWIFNV 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 79/222 (36%)
Tryp_SPc 42..264 CDD:238113 80/224 (36%)
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 79/222 (36%)
Tryp_SPc 25..242 CDD:238113 78/221 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.