DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and CG3650

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_611971.1 Gene:CG3650 / 37974 FlyBaseID:FBgn0035070 Length:249 Species:Drosophila melanogaster


Alignment Length:246 Identity:83/246 - (33%)
Similarity:125/246 - (50%) Gaps:22/246 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLVNLSLGATVRRPRLDGRIVGGQVANIKDI-PYQVSLQRSYHF-CGGSLIAQGWVLTAAHCTEG 85
            ||:.|:.|      ::..|||||....:..: .:.|:|:....| |||||:....|:|||||.:|
  Fly    13 LLLGLASG------QIQPRIVGGTTTTLSAVGGFVVNLRYDGTFYCGGSLVTSSHVVTAAHCLKG 71

  Fly    86 SAILLSKVRIGSSRTSVGGQLVGIKRVHRH--PK-FDAYTIDFDFSLLELEE-YSAKNVTQAFVG 146
            .......|:.|.|:.|..|.   ::||.|:  |. |.:.::::|..::.|:. .:...:|.    
  Fly    72 YQASRITVQGGVSKLSQSGV---VRRVARYFIPNGFSSSSLNWDVGVIRLQSALTGSGITT---- 129

  Fly   147 LPEQDADIADGTPVLVSGWGNTQSAQET-SAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGL 210
            :|........|..:.|||||.|:....: |..||:|.:..:.:..|..||....::|....||  
  Fly   130 IPLCQVQWNPGNYMRVSGWGTTRYGNSSPSNQLRTVRIQLIRKKVCQRAYQGRDTLTASTFCA-- 192

  Fly   211 PEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWI 261
            ..||||:|.|||||.:.....|.|:||||.|||...|||||:.|..||.:|
  Fly   193 RTGGKDSCSGDSGGGVIFKNQLCGIVSWGLGCANAQYPGVYTSVHRVRSFI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 78/226 (35%)
Tryp_SPc 42..264 CDD:238113 78/227 (34%)
CG3650NP_611971.1 Tryp_SPc 25..243 CDD:214473 78/226 (35%)
Tryp_SPc 26..243 CDD:238113 77/225 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.