DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and CG9897

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001286753.2 Gene:CG9897 / 37651 FlyBaseID:FBgn0034807 Length:265 Species:Drosophila melanogaster


Alignment Length:268 Identity:76/268 - (28%)
Similarity:116/268 - (43%) Gaps:34/268 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLVNLSLGATVRRPRL---DGRIVGGQVANIKDIPYQVS-LQRSYHFCGGSLIAQGWVLTAAHCT 83
            :|..|.|...|..|.|   |.||:.|...||||.|:..| :..|...|||::|::.::||||.|.
  Fly     1 MLAPLILLQIVALPWLALGDQRIINGNTVNIKDAPWYASIIVNSKLKCGGAIISKNYILTAAKCV 65

  Fly    84 EGSAILLSKVRIGSSRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLP 148
            :|.:....:||:|:|.....|.:.||.:|..|.::.::..|.:.:||:..|  ..|.|.....:.
  Fly    66 DGYSARSIQVRLGTSSCGTSGSIAGICKVKVHSQYSSWRFDNNLALLKTCE--LLNTTDEIKPIE 128

  Fly   149 EQDADIADGTPVLVSGWGN------------------TQSAQETSAVLRSVTVPKVSQTQCTE-- 193
            ..|....|.:...|:|.|.                  .:...:....|....|..:||.||..  
  Fly   129 RADKVPDDNSRANVTGCGGRSGNFLDLILDLRISSGIEEKCFQLPVQLHGTQVRILSQKQCAADW 193

  Fly   194 ---AYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVS 255
               .:.....|:|..:|...|  ||.||..|.|.||..|..|.|::|.. ||:..  |.||:.:.
  Fly   194 KVIPFYLLKGISDLTICTKSP--GKGACSTDRGSPLVIDNKLVGILSRA-GCSIK--PDVYANIL 253

  Fly   256 AVRDWISS 263
            ...:|:.|
  Fly   254 GHTNWLDS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 67/243 (28%)
Tryp_SPc 42..264 CDD:238113 68/246 (28%)
CG9897NP_001286753.2 Tryp_SPc 22..258 CDD:214473 67/242 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.