DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and CG32833

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_726278.1 Gene:CG32833 / 37650 FlyBaseID:FBgn0052833 Length:268 Species:Drosophila melanogaster


Alignment Length:235 Identity:62/235 - (26%)
Similarity:108/235 - (45%) Gaps:26/235 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VGGQVANIKDIPYQVSLQ-RSYHFCGGSLIAQGWVLTAAHCTEGSAILLSKVRIGSSRTSVGGQL 106
            :||...||...|:..|:. :....|.|::.....::||..|.:|....:.:||:||:..|.|...
  Fly    39 LGGHPVNITTAPWIASISIKQKAKCDGAIYKLSHIVTAGKCVDGFLNKVIRVRVGSTTRSDGVIE 103

  Fly   107 VGIKRVHRHPKFDAYTIDFDFSLLEL-EEYSAKNVTQAFVGLPEQDAD--IADGTPVLVSGWGN- 167
            |.:..:..|.||...|:..:.::|:| |...|....|     |.|.|:  .::|..|..:||.: 
  Fly   104 VAVCNITVHEKFTGQTVFHNVAILKLCEPLEASKTIQ-----PIQLANQLPSNGAKVTANGWPSF 163

  Fly   168 -------TQSAQETSAVLRSVTVPKVSQTQCTE--AYGNFG--SITDRMLCAGLPEGGKDACQGD 221
                   .:...:.:..|:...|..:..:|||:  |..|:.  :.||.:.|.  .:..|:||...
  Fly   164 RWWAMYWKKCLDDEAYKLQKAEVKLLGPSQCTDLWARNNWSKKNFTDDLFCT--EKFAKEACSLA 226

  Fly   222 SGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWI 261
            .|.|:..:|.|.|:::.| ||:  .||.||..:...:||:
  Fly   227 MGSPVVHNGKLVGIITKG-GCS--EYPEVYINLIKYKDWL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 61/233 (26%)
Tryp_SPc 42..264 CDD:238113 62/235 (26%)
CG32833NP_726278.1 Tryp_SPc 40..266 CDD:238113 62/234 (26%)
Tryp_SPc 40..262 CDD:214473 60/231 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.