DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Ser8

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster


Alignment Length:261 Identity:100/261 - (38%)
Similarity:148/261 - (56%) Gaps:24/261 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ILHLFIGGILLVN---LSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQRS-YHFCGGSLIAQG 74
            ::..|:..:.|.|   :.:|...:...|.||||||..::|:|.|:||||||| .||||||:|:..
  Fly     4 LIATFLALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNN 68

  Fly    75 WVLTAAHCTEGSAILLS-KVRIGSSRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEE---- 134
            .::|||||.:....:.: ::|.||::.:.||.||.:..:..|..:::.:...|..::.|:.    
  Fly    69 IIVTAAHCLDTPTTVSNLRIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTF 133

  Fly   135 -YSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQTQC---TEAY 195
             .:.|.:|.|       .|..|.|:...:||||.|.:...:||.|..|....|.::||   |..|
  Fly   134 GSTIKAITMA-------SATPAHGSAASISGWGKTSTDGPSSATLLFVDTRIVGRSQCGSSTYGY 191

  Fly   196 GNFGSITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDW 260
            |:|  |...|:||...  .||||||||||||.:.|.|.||||||..||..||||||:.::.:|||
  Fly   192 GSF--IKATMICAAAT--NKDACQGDSGGPLVSGGQLVGVVSWGRDCAVANYPGVYANIAELRDW 252

  Fly   261 I 261
            :
  Fly   253 V 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 93/229 (41%)
Tryp_SPc 42..264 CDD:238113 93/230 (40%)
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 93/229 (41%)
Tryp_SPc 35..253 CDD:238113 92/228 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443369
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
76.860

Return to query results.
Submit another query.