DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Prss3

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001102096.1 Gene:Prss3 / 362347 RGDID:1311446 Length:246 Species:Rattus norvegicus


Alignment Length:227 Identity:98/227 - (43%)
Similarity:129/227 - (56%) Gaps:12/227 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DGRIVGGQVANIKDIPYQVSLQRSYHFCGGSLIAQGWVLTAAHCTEGSAILLSKVRIGSSRTSV- 102
            |.:||||.......:||||||...|||||||||...||::||||.:...    :||:|....:| 
  Rat    21 DDKIVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKTRI----QVRLGEHNINVL 81

  Fly   103 --GGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIADGTPVLVSGW 165
              ..|.|...::.:||.|:|..::.|..|::|......|...|.|.||...|..  ||..|:|||
  Rat    82 EGDEQFVNAAKIIKHPNFNARNLNNDIMLIKLSSPVKLNARVATVALPSSCAPA--GTQCLISGW 144

  Fly   166 GNTQS-AQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAAD 229
            |||.| ......:|:.:..|.:.|..|..:|.  |.||:.|:|.|..|||||:||||||||:..:
  Rat   145 GNTLSLGVNNPDLLQCLDAPVLPQADCEASYP--GKITNNMICVGFLEGGKDSCQGDSGGPVVCN 207

  Fly   230 GVLWGVVSWGYGCARPNYPGVYSRVSAVRDWI 261
            |.|.|:||||||||..:.||||::|....|||
  Rat   208 GQLQGIVSWGYGCALKDNPGVYTKVCNYVDWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 95/223 (43%)
Tryp_SPc 42..264 CDD:238113 97/224 (43%)
Prss3NP_001102096.1 Tryp_SPc 23..239 CDD:214473 95/223 (43%)
Tryp_SPc 24..242 CDD:238113 97/224 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 187 1.000 Domainoid score I3235
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 1 1.000 - - mtm8983
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.