DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Prss37

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_038963710.1 Gene:Prss37 / 362346 RGDID:1311823 Length:249 Species:Rattus norvegicus


Alignment Length:239 Identity:49/239 - (20%)
Similarity:88/239 - (36%) Gaps:61/239 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PYQVSLQRSYHFCGGSLIAQGWVLTAAHC-TEGSAILL----SKVRIGSSRTSVGGQLVGIKRVH 113
            ||...|:.:::.|.|.||...|||..:|| .....::|    |:||.|:.:|....|::      
  Rat    40 PYLAYLKSNFNPCVGVLIKASWVLAPSHCYLPNLRVMLGNFKSRVRDGTEQTIYPIQII------ 98

  Fly   114 RHPKFDAYTIDFDFSLLELEEYSA-KNVTQAFVGLPEQDADIADGTPVLVSG--WGNTQSAQETS 175
            |:..:.......|..|::|.:.:. .|..|.   ||....::..||...:||  |....:.:...
  Rat    99 RYWNYSHTAPQDDLMLIKLAKPATFNNKVQV---LPIATTNVRPGTICTLSGLDWSQENNGRHPD 160

  Fly   176 AVLRSVTVPKVSQTQC--TEAYGN--------FGSITDR---------MLCAGLPEGGKDACQGD 221
             :.:::..|.::...|  |:...|        ||.:..|         ::|       |:..||.
  Rat   161 -LRQNLEAPVMTDKDCQKTQQGSNHRNSLCVKFGKVFSRIFGEVAVATVIC-------KNKLQGI 217

  Fly   222 SGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWISSVS 265
            ..|......|                 |:|:.:.:...||...:
  Rat   218 EVGHFMGGDV-----------------GIYTNIYSYVPWIEKTT 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 47/233 (20%)
Tryp_SPc 42..264 CDD:238113 49/236 (21%)
Prss37XP_038963710.1 Tryp_SPc 40..243 CDD:419748 49/236 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.