DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and thetaTry

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:276 Identity:104/276 - (37%)
Similarity:145/276 - (52%) Gaps:42/276 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LHLFIGGILLVNLSLGA----TVRRPRLD-----GRIVGGQVANIKDIPYQVSLQ--RSYHFCGG 68
            :|..:  :|||.|::|:    ||.....|     ||||||:...|...|||||||  ...|||||
  Fly     1 MHRLV--VLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGG 63

  Fly    69 SLIAQGWVLTAAHCTEGSAILLSKVRIGSSRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELE 133
            |||.:..|:|||||..|..:....||:||:..:.||.:|.::.:..:..:::.|:::|..:|:|:
  Fly    64 SLINEDTVVTAAHCLVGRKVSKVFVRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLD 128

  Fly   134 EYSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQTQCTEAYGN- 197
            |...:.....::.|..:..  ..||..:|:|||       :......:|:||..|    |.|.| 
  Fly   129 EKVKETENIRYIELATETP--PTGTTAVVTGWG-------SKCYFWCMTLPKTLQ----EVYVNI 180

  Fly   198 ------------FGSIT-DRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPG 249
                        :|.|. |.|:||  .|..|||||||||||||....|.|:|||||.||....||
  Fly   181 VDWKTCASDEYKYGEIIYDSMVCA--YEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPG 243

  Fly   250 VYSRVSAVRDWISSVS 265
            |||.|.|:|.||.:.|
  Fly   244 VYSDVPALRKWILNAS 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 91/235 (39%)
Tryp_SPc 42..264 CDD:238113 92/237 (39%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 91/235 (39%)
Tryp_SPc 35..255 CDD:238113 90/234 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452464
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
65.850

Return to query results.
Submit another query.