DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and etaTry

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster


Alignment Length:269 Identity:106/269 - (39%)
Similarity:139/269 - (51%) Gaps:30/269 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MAKTILHLFIGGILLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQR------SY-HFCG 67
            |.|.||.     ||.|...||......:.|||||||...:.....|.|.|:|      || ..||
  Fly     1 MNKVILR-----ILAVLFLLGIYAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCG 60

  Fly    68 GSLIAQGWVLTAAHCT---EGSAILLSKVRIGSSRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSL 129
            |.::....:.|||||.   |....|:  |....||..:.|.:|.:.::..|..:::.|:|.|.:|
  Fly    61 GCILDAVTIATAAHCVYNREAENFLV--VAGDDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIAL 123

  Fly   130 ------LELEEYSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQ 188
                  |.|:.:|.....:.....|      |.|....:||||.|:....:|..|:.|.||.|..
  Fly   124 VVVDPPLPLDSFSTMEAIEIASEQP------AVGVQATISGWGYTKENGLSSDQLQQVKVPIVDS 182

  Fly   189 TQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSR 253
            .:|.||| .:..|::.||||||.|||||||||||||||.....|.|:||||.|||||||||||:.
  Fly   183 EKCQEAY-YWRPISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYAN 246

  Fly   254 VSAVRDWIS 262
            |:..:|||:
  Fly   247 VAYYKDWIA 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 93/235 (40%)
Tryp_SPc 42..264 CDD:238113 94/237 (40%)
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 93/235 (40%)
Tryp_SPc 28..257 CDD:238113 94/237 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.