DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and CG17571

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster


Alignment Length:257 Identity:104/257 - (40%)
Similarity:146/257 - (56%) Gaps:21/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LFIGGILLVNLSLGATVR-RPRLD---GRIVGGQVANIKDIPYQVSLQ--RSYHFCGGSLIAQGW 75
            |.:..:.||  :|.|:.. .|.||   ||||.|:..:|::.|||||:|  :..||||||||....
  Fly     4 LLLSVVALV--ALAASCHGNPGLDFPFGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSET 66

  Fly    76 VLTAAHCTEGSAILLSKVRIGSSRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNV 140
            |||||||.:..|....:||:||:..|.||::|.::....|..:::..:..|.::::|.  |....
  Fly    67 VLTAAHCMQSYAASELQVRVGSTSRSSGGEVVTVRAFKYHEGYNSKLMINDVAIIKLS--SPVRQ 129

  Fly   141 TQAFVGLPEQDADIADGTPVLVSGWGNT----QSAQETSAVLRSVTVPKVSQTQCTEAYGNFG-- 199
            |.....:...|::...||..:|||||.|    .|:.:|   |:.|.|..:....|.....|:|  
  Fly   130 TSKIRAIELADSEAVSGTNAVVSGWGTTCFLFCSSPDT---LQKVEVDLLHYKDCAADTYNYGSD 191

  Fly   200 SITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWI 261
            ||.:.|:||...:  ||||||||||||.||..|.||||||.|||...|||||:.|:::|.||
  Fly   192 SILETMVCATGEK--KDACQGDSGGPLVADNKLVGVVSWGSGCAWTGYPGVYADVASLRSWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 93/227 (41%)
Tryp_SPc 42..264 CDD:238113 94/228 (41%)
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 93/227 (41%)
Tryp_SPc 31..254 CDD:238113 94/228 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443376
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
65.850

Return to query results.
Submit another query.