DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Send2

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster


Alignment Length:251 Identity:80/251 - (31%)
Similarity:119/251 - (47%) Gaps:32/251 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LFIGGILLV----NLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQR-SYHFCGGSLIAQGWV 76
            :||...||:    :||.|..:|.   :.||:|||...|::.|:|||:|| ..|.||||:.:...:
  Fly     1 MFIQSFLLLLALNSLSAGPVIRP---EERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADII 62

  Fly    77 LTAAHCTEGSAILLSKVRIGSSRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVT 141
            :|||||.:|...   :||.||:..:..|.:|.:..:..|.     .:..|.:::.|.:  ....|
  Fly    63 ITAAHCVQGQGY---QVRAGSALKNSNGSVVDVAAIRTHE-----GLGNDIAIVRLSK--PLEFT 117

  Fly   142 QAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRML 206
            .....:|....:...|:...|||||:: |.......|:.|.:.......|       |......:
  Fly   118 NQVQPIPLAKTNPPPGSIAFVSGWGSS-SYYSHPIDLQGVNLYIQWPYYC-------GLTEPSRI 174

  Fly   207 CAGLPEGGKDACQGDSGGPLAADGVLWGVVSWG-YGCARPNYPGVYSRVSAVRDWI 261
            |||  ..|:.||:|||||||..|..|.||||.| ..|   .|..:|:.|...|:||
  Fly   175 CAG--SFGRAACKGDSGGPLVFDQQLVGVVSGGTKDC---TYSSIYTSVPYFREWI 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 70/221 (32%)
Tryp_SPc 42..264 CDD:238113 71/222 (32%)
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 70/221 (32%)
Tryp_SPc 27..225 CDD:238113 69/220 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.