DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Phae1

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster


Alignment Length:259 Identity:85/259 - (32%)
Similarity:122/259 - (47%) Gaps:18/259 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LHLFIGGILLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQ-RSYHFCGGSLIAQGWVLT 78
            |.|.:|...:..:::||.      :||:|||..|.:...||.||:| ...|:|..|::...|::|
  Fly    15 LLLLLGICRISGVAIGAP------EGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVT 73

  Fly    79 AAHC-TEGSAILLSKVRIGSSRTSVGGQLVGIKRVHRHPKFDAY---TIDFDFSLLELEEYSAKN 139
            |||| |..:.:|.|.:..||............:.:......|.|   |:.:|..::........:
  Fly    74 AAHCLTNSNQVLGSTLVAGSIAVDGTASTTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAFVWS 138

  Fly   140 VTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETS--AVLRSVT-VPKVSQTQCTEAYGNFGS- 200
            ...|.|.||.... :..||..|. |||:|.:....|  :.|:..| ||.:|.:.|..|.|..|| 
  Fly   139 AAVAPVTLPSSGV-VPTGTANLY-GWGSTSTTNTASYPSTLQVATNVPIISLSSCESALGTKGSD 201

  Fly   201 ITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWG-YGCARPNYPGVYSRVSAVRDWISS 263
            :....||.|...||...|..||||||....||.|:|||| ..|.:.|.|.||.:||:...|||:
  Fly   202 VHSTNLCTGPLTGGVSICTSDSGGPLVQGNVLIGIVSWGKLPCGQANSPSVYVQVSSFISWISA 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 76/229 (33%)
Tryp_SPc 42..264 CDD:238113 78/232 (34%)
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 76/229 (33%)
Tryp_SPc 36..266 CDD:238113 78/232 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.