DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and PRSS53

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:333 Identity:83/333 - (24%)
Similarity:121/333 - (36%) Gaps:110/333 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GGILLVNLSLGATVRRPRL------------------DGRIVGGQVANIKDIPYQVSLQR-SYHF 65
            |.:||:   .||||....|                  :|..|.|      :.|:|.|::| ..|.
Human     6 GPVLLI---AGATVLMEGLQAAQRACGQRGPGPPKPQEGNTVPG------EWPWQASVRRQGAHI 61

  Fly    66 CGGSLIAQGWVLTAAHCTEGSA---------ILLSKVRIGSSRTSVGGQLVGIKRVHRHPKFDAY 121
            |.|||:|..||||||||.|.:|         :|.|..|.|   .|.|.:.||:..:.....::.|
Human    62 CSGSLVADTWVLTAAHCFEKAAATELNSWSVVLGSLQREG---LSPGAEEVGVAALQLPRAYNHY 123

  Fly   122 TIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETS----------- 175
            :...|.:||:|    |...|...:.||:.......|.....:||.     |:||           
Human   124 SQGSDLALLQL----AHPTTHTPLCLPQPAHRFPFGASCWATGWD-----QDTSDGKCWPRLKLG 179

  Fly   176 ---------------------------------------AVLRSVTVPKVSQTQCTEAYGNF--- 198
                                                   ..||::.:..:|:..|...|...   
Human   180 EALCLPSVTVSAPNCPGFQSPLLPRSQTLAPAPSLSPAPGTLRNLRLRLISRPTCNCIYNQLHQR 244

  Fly   199 ---GSITDRMLCAGLPEGGKDACQGDSGGP---LAADG--VLWGVVSWGYGCARPNYPGVYSRVS 255
               ......|||.|...|.:..||||||||   |..||  |..|::|:...||:.:.|.:.:..:
Human   245 HLSNPARPGMLCGGPQPGVQGPCQGDSGGPVLCLEPDGHWVQAGIISFASSCAQEDAPVLLTNTA 309

  Fly   256 AVRDWISS 263
            |...|:.:
Human   310 AHSSWLQA 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 73/290 (25%)
Tryp_SPc 42..264 CDD:238113 74/293 (25%)
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113 74/291 (25%)
Tryp_SPc 43..314 CDD:214473 73/288 (25%)
Tryp_SPc 359..>512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149425
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.