DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and prss60.3

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:275 Identity:110/275 - (40%)
Similarity:148/275 - (53%) Gaps:30/275 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LTGMAKTILHLFIGGILLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQR-SY--HFCGG 68
            ||....|:|....|.:..:|:...|.     |:.|||||..|:....|:||||.. .|  |||||
Zfish     6 LTCATLTLLICVKGSLSQLNVCGQAP-----LNTRIVGGVNASPGSWPWQVSLHSPKYGGHFCGG 65

  Fly    69 SLIAQGWVLTAAHCTEGSAILLSKVRIGSSRTSVGGQLVGIKRVHR-------HPKFDAYTIDFD 126
            |||:..||||||||..|.:.....|.:| .||..|   :.|....|       |..:::.|.|.|
Zfish    66 SLISSEWVLTAAHCLSGVSETTLVVYLG-RRTQQG---INIYETSRNVAKSFVHSSYNSNTNDND 126

  Fly   127 FSLLELEEYSAKNVTQAF--VGLPEQDADIADGTPVLVSGWGNTQSAQETSA--VLRSVTVPKVS 187
            .:||.|.  ||...|...  |.|..|::..:.||...::|||:.|:.....|  :|:...:|.|:
Zfish   127 IALLRLS--SAVTFTNYIRPVCLAAQNSVYSAGTSSWITGWGDIQAGVNLPAPGILQETMIPVVA 189

  Fly   188 QTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAAD-GVLW---GVVSWGYGCARPNYP 248
            ..:|....|: |::|:.|:||||.:||||.||||||||:... ..:|   |:.|||||||.||.|
Zfish   190 NDRCNALLGS-GTVTNNMICAGLTQGGKDTCQGDSGGPMVTRLCTVWVQAGITSWGYGCADPNSP 253

  Fly   249 GVYSRVSAVRDWISS 263
            |||:|||..:.||||
Zfish   254 GVYTRVSQYQSWISS 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 98/237 (41%)
Tryp_SPc 42..264 CDD:238113 101/240 (42%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 101/240 (42%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.