DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and CG4271

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:203 Identity:58/203 - (28%)
Similarity:95/203 - (46%) Gaps:16/203 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 YHFCGGSLIAQGWVLTAAHCTEGSAILLSKVRIGSSRTSVGGQLVGIKRVHRHPKFDAYTIDFDF 127
            ||.|||::|....|||||.|.:...:....||:|:.....||:::.:..:..|..:..:  |.|.
  Fly    41 YHECGGAVIDSRIVLTAAQCVKNKPVKRITVRVGTPDIYRGGRIIRVTALVVHENYKNW--DNDI 103

  Fly   128 SLLELEE-YSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSAVLRSVT--VPKV-SQ 188
            :||.||: ..:..||:    :|....:.::......:|||  :...|:..|.|.:.  |.|: .:
  Fly   104 ALLWLEKPVLSVRVTK----IPLATKEPSENEYPSNAGWG--EKLLESYVVTRKLQNGVTKIRPR 162

  Fly   189 TQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSR 253
            :.|.|..  ...:.:.:|||...|  .|.|.||.||||.....:.|:...|:||.....|.:|:.
  Fly   163 SMCAEEL--VEPVGEELLCAFYTE--NDICPGDYGGPLVLANKVVGIAVQGHGCGFAVLPSLYTN 223

  Fly   254 VSAVRDWI 261
            |....:||
  Fly   224 VFHYLEWI 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 56/201 (28%)
Tryp_SPc 42..264 CDD:238113 58/203 (29%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 58/203 (29%)
Tryp_SPc 19..231 CDD:214473 56/201 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.