DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and CG11911

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster


Alignment Length:243 Identity:79/243 - (32%)
Similarity:116/243 - (47%) Gaps:26/243 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GRIVGGQVANIKDIPYQVSLQRSY----HFCGGSLIAQGWVLTAAHCTE---GSAILLSKVRIGS 97
            |.::.|..|.....||.|||..:|    |.|||:||.:.|::|||||..   |.:|:...    .
  Fly    35 GFVINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINKDWIVTAAHCISEPVGMSIIAGL----H 95

  Fly    98 SRTSVG----GQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIADGT 158
            :|..|.    .:.|...|||.  |:......:|.:||.:.|....|.......||.:: .:.:|.
  Fly    96 TRAEVDELTQQRQVDFGRVHE--KYTGGVGPYDIALLHVNESFIFNEWVQPATLPSRE-QVHEGE 157

  Fly   159 PVLVSGWGNTQSAQETSA-VLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDS 222
            ..|. |||..:|...:.| .|::||...::..:|.|.......|.:..:|:...:..|.||.|||
  Fly   158 THLY-GWGQPKSYIFSGAKTLQTVTTQILNYEECKEELPESAPIAESNICSSSLQQSKSACNGDS 221

  Fly   223 GGPLA-----ADGVLWGVVSWGY-GCARPNYPGVYSRVSAVRDWISSV 264
            ||||.     |...|.|:||||| .|...|.|.:|::|||..|||:::
  Fly   222 GGPLVVEFTNAPSELIGIVSWGYIPCGLANMPSIYTKVSAYIDWITNI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 76/237 (32%)
Tryp_SPc 42..264 CDD:238113 78/239 (33%)
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 78/239 (33%)
Tryp_SPc 37..266 CDD:214473 76/236 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.