DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and CG1304

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:263 Identity:81/263 - (30%)
Similarity:135/263 - (51%) Gaps:23/263 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LFIGGILLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQRS-YHFCGGSLIAQGWVLTAA 80
            :.:|..||: |::........|:||:|||:.|.....|:||||:.: .|.||||::::.:|||||
  Fly     8 ILLGSFLLL-LAVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAA 71

  Fly    81 HC-----TEGSAILLS----KVRIGSSRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYS 136
            ||     :.|:::.::    .:|.||:....||.||.:..|..|.::..:.  .|.:||.||...
  Fly    72 HCVTNQDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFL--NDVALLRLESPL 134

  Fly   137 AKNVTQAFVGLPEQD--ADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFG 199
            ..:.:...:.||..|  ||:    .|::||||..:...:....|:..|:..:|..:|.|..| :|
  Fly   135 ILSASIQPIDLPTADTPADV----DVIISGWGRIKHQGDLPRYLQYNTLKSISLERCDELIG-WG 194

  Fly   200 SITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWISSV 264
            ..::  ||. :.|....||.||||||...:..:.||..:.:.....:||..|:||....:||.:.
  Fly   195 VQSE--LCL-IHEADNGACNGDSGGPAVYNNQVVGVAGFVWSACGTSYPDGYARVYYHNEWIKNN 256

  Fly   265 SGI 267
            |.:
  Fly   257 SDV 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 72/231 (31%)
Tryp_SPc 42..264 CDD:238113 73/233 (31%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 72/231 (31%)
Tryp_SPc 32..256 CDD:238113 73/233 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.