DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Prss34

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_848459.1 Gene:Prss34 / 328780 MGIID:2681414 Length:318 Species:Mus musculus


Alignment Length:272 Identity:95/272 - (34%)
Similarity:129/272 - (47%) Gaps:39/272 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IGGILLVNLSLGATVRRPRLDGR----IVGGQVANIKDIPYQVSLQ-------RSYHFCGGSLIA 72
            :|..:.:.|.||:        |:    ||||...:....|:||||:       |..|.||||||.
Mouse    16 LGNTMPLTLDLGS--------GQGLVGIVGGCPVSASRFPWQVSLRLYDMEHSRWEHECGGSLIH 72

  Fly    73 QGWVLTAAHCTEGSAILL--SKVRIGSSRTSVGGQLVGIKRVHRHPKFD---AYTIDFDFSLLEL 132
            ..||||||||.....:..  .:|::|..|.....||:.:.::.|||||.   :.....|.:||:|
Mouse    73 PQWVLTAAHCVRPKEVEAYGVRVQVGQLRLYENDQLMKVVKIIRHPKFSEKLSARGGADIALLKL 137

  Fly   133 EEYSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSAV--LRSVTVPKVSQTQCTEAY 195
            :.....:.....|.||.....|:......|:|||..::.......  ||.|.||.|....|.:.|
Mouse   138 DTRVVLSEHVYPVSLPAASLRISSKKTCWVAGWGVIENYMPLPPPYHLREVAVPIVENNDCEQKY 202

  Fly   196 GNFGS-------ITDRMLCAGLPEGGKDACQGDSGGPLA----ADGVLWGVVSWGYGCARPNYPG 249
            ....|       |.|.|||||  :.|:|:|:.||||||.    ...|..||||||.||..|::||
Mouse   203 QTNSSSDSTTRIIKDDMLCAG--KEGRDSCKADSGGPLVCRWNCSWVQVGVVSWGIGCGLPDFPG 265

  Fly   250 VYSRVSAVRDWI 261
            ||:||.:...||
Mouse   266 VYTRVMSYVSWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 88/248 (35%)
Tryp_SPc 42..264 CDD:238113 90/245 (37%)
Prss34NP_848459.1 Tryp_SPc 35..278 CDD:238113 90/245 (37%)
Tryp_SPc 35..277 CDD:214473 88/243 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.