DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and CG9672

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster


Alignment Length:261 Identity:76/261 - (29%)
Similarity:122/261 - (46%) Gaps:30/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LHLFIGGILLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQ--VSLQRSYHFCGGSLIAQGWVL 77
            |.|.||   |:.::.|....:|:  |||.||:.|.:..:|||  :|:..||: ||..:|.|.:.|
  Fly     3 LTLTIG---LILVAAGVLEAQPQ--GRIAGGEDAVLGQLPYQAALSIGGSYN-CGAVIIGQRYAL 61

  Fly    78 TAAH--CTEGS----AILLSKVRIGSSRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYS 136
            ||..  |::|.    |.:|..|.:||. ....|:.:.::.:..:|.:.  |:....:||.|:|..
  Fly    62 TALSCVCSDGKDTPWAAVLFAVTVGSV-DLYNGKQIRVEEITINPNYS--TLKTGIALLRLQEEI 123

  Fly   137 AKNVTQAFVGLPEQDADIAD-GTPVLVSGWG-NTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFG 199
            ..:.|...:.|.:   |:.. |:.|.||||| .|:|.......|:......::..:|  |..|..
  Fly   124 TFSETVNAIPLSQ---DVPPMGSQVEVSGWGRTTESEVNMHRTLQIGAAEVMAPREC--ALANRD 183

  Fly   200 SI---TDRMLCAGLPEGGKDA-CQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDW 260
            .:   .|::||.|  .|.:.. |.||.|||....|.|.|:.:...|......|..:..::|..||
  Fly   184 ELLVADDQVLCLG--HGRRQGICSGDIGGPAVYQGQLVGLGAQILGECGGMLPERFISIAANYDW 246

  Fly   261 I 261
            |
  Fly   247 I 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 66/233 (28%)
Tryp_SPc 42..264 CDD:238113 67/234 (29%)
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 66/233 (28%)
Tryp_SPc 25..250 CDD:238113 67/234 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.