DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and sphe

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:232 Identity:72/232 - (31%)
Similarity:118/232 - (50%) Gaps:21/232 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GRIVGGQVANIKDIPYQVSLQ-RSYHFCGGSLIAQGWVLTAAHCT--EGSAILLSKV--RIGSSR 99
            |||:||:.|:.....:..||: .:.|.||||:::|..:||.|||.  :|..|..|::  |:||:.
  Fly    24 GRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVGSTN 88

  Fly   100 TSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLP---EQDADIADGTPVL 161
            ...||::|.::.|..||  |.|.::.:.:::.|.  |....|.....:|   ..:|..|:|:.|:
  Fly    89 QYAGGKIVNVESVAVHP--DYYNLNNNLAVITLS--SELTYTDRITAIPLVASGEALPAEGSEVI 149

  Fly   162 VSGWGNTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAG--LPEGGKDACQGDSGG 224
            |:|||.| |....|..:|.:::....:..|.:||.:.   .::..|..  |.||   .|.||.||
  Fly   150 VAGWGRT-SDGTNSYKIRQISLKVAPEATCLDAYSDH---DEQSFCLAHELKEG---TCHGDGGG 207

  Fly   225 PLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWI 261
            .......|.|:.::..|.....||.|:.|:|:..|||
  Fly   208 GAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 69/229 (30%)
Tryp_SPc 42..264 CDD:238113 70/230 (30%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 66/214 (31%)
Tryp_SPc 42..244 CDD:214473 64/212 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.