DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and CG32834

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster


Alignment Length:260 Identity:78/260 - (30%)
Similarity:118/260 - (45%) Gaps:33/260 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VNLSLGATVRRP---RLD--GRIVGGQVANIKDIPYQVS-LQRSYHFCGGSLIAQGWVLTAAHCT 83
            |.|.|.|.:.||   .||  .||:||...:|:|.|||.. :......|.|::|....::|||.|.
  Fly     5 VFLFLLAALLRPVRGDLDAQSRIIGGYDVDIEDAPYQAEVIIDGTAICSGAIITSDTIITAASCV 69

  Fly    84 EGSAILLSKVRIG-SSRTSVG-GQLVGIKRVHRHPKFDAYTIDFDFSLLEL-EEYSAKNVTQAFV 145
            :....:  :||:| |||...| |.|:.:..:..||:::.:..|.:.:||:| :........|. :
  Fly    70 QSYGSI--EVRVGTSSRDYDGTGFLLEVCEIINHPQYNCWRFDNNLALLKLCDPLKTSEAIQP-I 131

  Fly   146 GLPEQDADIADGTPVLVSGWGNT--------QSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSIT 202
            .:.|.:.|  ||:...|||||:|        :........|:...|...::.||....|.:..:.
  Fly   132 SIAEDEPD--DGSWCTVSGWGSTSWWGSWWDRCFGSLPDYLQMAWVSVYNREQCAADRGVWFGLW 194

  Fly   203 DR-----MLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWIS 262
            |.     .||.   ..|...|..|:|.||..||.|.|::|.| ||.  ..|.||:.|.....||:
  Fly   195 DNGISYLTLCT---HNGAGGCSYDTGAPLVIDGQLVGILSEG-GCT--TKPDVYANVPWFTGWIA 253

  Fly   263  262
              Fly   254  253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 68/236 (29%)
Tryp_SPc 42..264 CDD:238113 69/238 (29%)
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 68/236 (29%)
Tryp_SPc 27..255 CDD:238113 69/238 (29%)
BES1_N <293..343 CDD:283367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.