DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and CG32808

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster


Alignment Length:235 Identity:88/235 - (37%)
Similarity:123/235 - (52%) Gaps:18/235 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DGRIVGGQVANIKDIPYQVSLQRS---YHFCGGSLIAQGWVLTAAHCTEGSAILLSKVRIGS--- 97
            ||:||.|..|...:.|:.|||:|:   .|.||.:|:...||||||||..||:.....::.||   
  Fly    27 DGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLDLQYGSQML 91

  Fly    98 SRTSVGGQLVGIKRVHRHPKF---DAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIADGTP 159
            :|.|  .|:..:..:..||.:   |.|.  .|.:||:|.:..|.:.....|.|||..........
  Fly    92 ARNS--SQVARVAAIFVHPGYEPEDKYV--NDIALLQLAQSVALSKFVQPVRLPEPRQVTPGNAS 152

  Fly   160 VLVSGWGNTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGG 224
            .:::|||...:.......|:.|.:...|.|:|:|.:..:  :.|..:|||||||||..|.|||||
  Fly   153 AVLAGWGLNATGGVVQQHLQKVKLQVFSDTECSERHQTY--LHDSQICAGLPEGGKGQCSGDSGG 215

  Fly   225 PLAADG--VLWGVVSWGY-GCARPNYPGVYSRVSAVRDWI 261
            ||...|  ...|:|||.. .||||.:|||::.|||..|||
  Fly   216 PLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 84/231 (36%)
Tryp_SPc 42..264 CDD:238113 86/232 (37%)
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 84/231 (36%)
Tryp_SPc 30..258 CDD:238113 86/232 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
44.020

Return to query results.
Submit another query.