DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and CG32376

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:229 Identity:86/229 - (37%)
Similarity:119/229 - (51%) Gaps:11/229 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RIVGGQVANIKDIPYQVSLQ-RSYHFCGGSLIAQGWVLTAAHCTEGSAILLSKVRIGSSRTSVGG 104
            |||.|:.....:.|:|.||. ..|..||..:|.:.|:|||.||..|.....: ||:||.:...||
  Fly    65 RIVNGKRIPCTEAPFQGSLHYEGYFVCGCVIINKIWILTAHHCFFGPPEKYT-VRVGSDQQRRGG 128

  Fly   105 QLVGIKRVHRHPKFDAYTIDFDFSLLELEE--YSAKNVTQAFVGLPEQDADIADGTPVLVSGWGN 167
            ||..:|::.....::.||:..|.::::|:.  |..|.|..  |.||.... .......:|||||.
  Fly   129 QLRHVKKIVALAAYNDYTMRHDLAMMKLKSPVYFGKCVRP--VKLPSTKT-TKFPKKFVVSGWGI 190

  Fly   168 TQ-SAQETSAVLRSVTVPKVSQTQCTEAYGNFG-SITDRMLCAGLPEGGKDACQGDSGGPLAADG 230
            |. :||.....||.|.:..:.:::|.:.|...| .|...|:||.  ...||:|.|||||||.:.|
  Fly   191 TSANAQNVQRYLRRVQIDYIKRSKCQKMYKKAGLKIYKDMICAS--RTNKDSCSGDSGGPLTSRG 253

  Fly   231 VLWGVVSWGYGCARPNYPGVYSRVSAVRDWISSV 264
            ||:|:||||.|||..||||||........||..|
  Fly   254 VLYGIVSWGIGCANKNYPGVYVNCKRYVPWIKKV 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 83/224 (37%)
Tryp_SPc 42..264 CDD:238113 84/226 (37%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 83/224 (37%)
Tryp_SPc 66..287 CDD:238113 84/226 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
43.910

Return to query results.
Submit another query.