DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and CG32260

DIOPT Version :10

Sequence 1:NP_523518.2 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster


Alignment Length:88 Identity:18/88 - (20%)
Similarity:30/88 - (34%) Gaps:35/88 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   403 ASSTAGSAGGPTVSF----------------------------AGSTLLPGQLSPLPS-----TS 434
            |.||:..:..||:|.                            .|:.|:||....|.:     |.
  Fly     7 AKSTSLFSSNPTISAKIGQNPRGVRSVYPTVRMQSRVHRLIEEQGAVLIPGVYDALSAAIVQQTG 71

  Fly   435 YLPSSSVAGGYRSSSTSSPLPGF 457
            :  |:::..||..|:.:...|.|
  Fly    72 F--SAALISGYALSAVTLGKPDF 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_523518.2 Tryp_SPc 42..264 CDD:238113
CG32260NP_728942.1 CLIP 194..244 CDD:463440
Tryp_SPc 328..571 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.