DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Klk15

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_777354.1 Gene:Klk15 / 317652 MGIID:2447533 Length:254 Species:Mus musculus


Alignment Length:262 Identity:86/262 - (32%)
Similarity:125/262 - (47%) Gaps:34/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LFIGGILLVNLSLGATVRRPRLDG-RIVGGQVANIKDIPYQVSL-QRSYHFCGGSLIAQGWVLTA 79
            |.:..:|||:.:         .|| :::.|:.......|:||:| :|....||..||:..|||||
Mouse     3 LLLAFVLLVSAA---------QDGDKVLEGEECVPHSQPWQVALFERGRFNCGAFLISPRWVLTA 58

  Fly    80 AHCTEGSAILLSKVRIG--SSRTSVG-GQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVT 141
            |||    .....:||:|  :.|...| .||..:.|:..||.::|.|...|..||.|.:.:.....
Mouse    59 AHC----QTRFMRVRLGEHNLRKFDGPEQLRSVSRIIPHPGYEARTHRHDIMLLRLFKPARLTAY 119

  Fly   142 QAFVGLPEQDADIADGTPVLVSGW-----------GNTQSAQETSAVLRSVTVPKVSQTQCTEAY 195
            ...|.||.:...|  |...:||||           |:.:|.......|....:..:|:..|.:.|
Mouse   120 VRPVALPRRCPLI--GEDCVVSGWGLLSDNNPGATGSQKSHVRLPDTLHCANISIISEASCNKDY 182

  Fly   196 GNFGSITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWG-YGCARPNYPGVYSRVSAVRD 259
            .  |.:...|:|||:..||.|:|:|||||||...|.|.|:|||| ..|.....||||::|.:..:
Mouse   183 P--GRVLPTMVCAGVEGGGTDSCEGDSGGPLVCGGALQGIVSWGDVPCDTTTKPGVYTKVCSYLE 245

  Fly   260 WI 261
            ||
Mouse   246 WI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 78/235 (33%)
Tryp_SPc 42..264 CDD:238113 80/236 (34%)
Klk15NP_777354.1 Tryp_SPc 23..247 CDD:238113 78/231 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.