DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and LOC312273

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001101326.1 Gene:LOC312273 / 312273 RGDID:1563848 Length:246 Species:Rattus norvegicus


Alignment Length:226 Identity:91/226 - (40%)
Similarity:126/226 - (55%) Gaps:11/226 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DGRIVGGQVANIKDIPYQVSLQRSYHFCGGSLIAQGWVLTAAHCTEGSAILLSKVRIGSSRT-SV 102
            |.|||||.......:||||||....|.||||||...|||:||||.....    :||:|.... .:
  Rat    22 DDRIVGGYTCQEHSVPYQVSLNAGSHICGGSLITDQWVLSAAHCYHPQL----QVRLGEHNIYEI 82

  Fly   103 GG--QLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIADGTPVLVSGW 165
            .|  |.:...::..||.:|.:|:|.|..|::|:..:..|...:.:.||:...  ..||..|||||
  Rat    83 EGAEQFIDAAKMILHPDYDKWTVDNDIMLIKLKSPATLNSKVSTIPLPQYCP--TAGTECLVSGW 145

  Fly   166 GNTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAADG 230
            |..:...|:.:||:.:..|.:|.:.|.:||..  .||:.|.|.|..|||||:||.|||||:..:|
  Rat   146 GVLKFGFESPSVLQCLDAPVLSDSVCHKAYPR--QITNNMFCLGFLEGGKDSCQYDSGGPVVCNG 208

  Fly   231 VLWGVVSWGYGCARPNYPGVYSRVSAVRDWI 261
            .:.|:||||.|||....||||::|....:||
  Rat   209 EVQGIVSWGDGCALEGKPGVYTKVCNYLNWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 88/222 (40%)
Tryp_SPc 42..264 CDD:238113 89/223 (40%)
LOC312273NP_001101326.1 Tryp_SPc 25..242 CDD:238113 89/223 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 187 1.000 Domainoid score I3235
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 1 1.000 - - mtm8983
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.