DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Prss30

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:254 Identity:98/254 - (38%)
Similarity:131/254 - (51%) Gaps:42/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GRIVGGQVANIKDIPYQVSL--QRSYHFCGGSLIAQGWVLTAAHCTEGSAILLS----KVRIGSS 98
            |:|||||.|.....|:||||  ....|.||||||.:.||||||||...|   |:    .|::|..
Mouse    72 GKIVGGQDALEGQWPWQVSLWITEDGHICGGSLIHEVWVLTAAHCFRRS---LNPSFYHVKVGGL 133

  Fly    99 RTSV---GGQLVGIKRVHRHPKF---DAYTIDFDFSLLELE------EYSAKNVTQAFVGLPEQD 151
            ..|:   ...||.::.:..||.:   ||.:  .|.:|::|:      :::.       |.||...
Mouse   134 TLSLLEPHSTLVAVRNIFVHPTYLWADASS--GDIALVQLDTPLRPSQFTP-------VCLPAAQ 189

  Fly   152 ADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFGS-------ITDRMLCAG 209
            ..:..||...|:|||.||. ::.::||:.:.||.:....|.:.|...||       |...|||||
Mouse   190 TPLTPGTVCWVTGWGATQE-RDMASVLQELAVPLLDSEDCEKMYHTQGSSLSGERIIQSDMLCAG 253

  Fly   210 LPEGGKDACQGDSGGPLAAD-GVLW---GVVSWGYGCARPNYPGVYSRVSAVRDWISSV 264
            ..||.||:|||||||||... ...|   |:.|||.|||||..||||:||....|||..:
Mouse   254 YVEGQKDSCQGDSGGPLVCSINSSWTQVGITSWGIGCARPYRPGVYTRVPTYVDWIQRI 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 95/248 (38%)
Tryp_SPc 42..264 CDD:238113 97/250 (39%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 97/250 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.