DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Klk8

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001100979.1 Gene:Klk8 / 308565 RGDID:1305998 Length:260 Species:Rattus norvegicus


Alignment Length:259 Identity:88/259 - (33%)
Similarity:124/259 - (47%) Gaps:29/259 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLVNLSLGATVRRPRLDG-RIVGGQVANIKDIPYQVSL-QRSYHFCGGSLIAQGWVLTAAHCTEG 85
            :|:.|.:||.....|..| :|:.||.......|:|.:| |.....|||.|:...||||||||.:.
  Rat    13 ILLFLLMGAWAGLTRAQGSKILEGQECKPHSQPWQTALFQGERLVCGGVLVGDRWVLTAAHCKKD 77

  Fly    86 SAILLSKVRIGS---SRTSVGGQLVGIKRVHRHPKFDAYTID---FDFSLLELEEYSAKNVTQAF 144
            .    ..||:|.   .:.....|.:.:.|..:||.|::...:   .|..|:.|:       ..|.
  Rat    78 K----YSVRLGDHSLQKRDEPEQEIQVARSIQHPCFNSSNPEDHSHDIMLIRLQ-------NSAN 131

  Fly   145 VGLPEQDADIAD-----GTPVLVSGWGNTQSAQET-SAVLRSVTVPKVSQTQCTEAYGNFGSITD 203
            :|...:..::|:     |...::||||...|.||. ...|....|...||.:|..||.  |.||:
  Rat   132 LGDKVKPIELANLCPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQNKCERAYP--GKITE 194

  Fly   204 RMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYG-CARPNYPGVYSRVSAVRDWISSVSG 266
            .|:||| ...|.|.|||||||||..:|||.|:.|||.. |.:|..||||:::....:||....|
  Rat   195 GMVCAG-SSNGADTCQGDSGGPLVCNGVLQGITSWGSDPCGKPEKPGVYTKICRYTNWIKKTMG 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 79/233 (34%)
Tryp_SPc 42..264 CDD:238113 81/235 (34%)
Klk8NP_001100979.1 Tryp_SPc 32..252 CDD:214473 79/233 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8983
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.