DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Tpsg1

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_783183.1 Gene:Tpsg1 / 302990 RGDID:631355 Length:311 Species:Rattus norvegicus


Alignment Length:237 Identity:90/237 - (37%)
Similarity:117/237 - (49%) Gaps:24/237 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RIVGGQVANIKDIPYQVSLQ-RSYHFCGGSLIAQGWVLTAAHCTEGSAILLS-KVRIGSSRTSVG 103
            |||||..|.....|:|.||: :..|.|||||::..||||||||..||..... :|.:|....::.
  Rat    29 RIVGGHAAQAGAWPWQASLRLQKVHVCGGSLLSPEWVLTAAHCFSGSVNSSDYEVHLGELTITLS 93

  Fly   104 GQLVGIKRVHRH------PKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIADGTPVLV 162
            .....:|::..:      |....     |.:|::|....|.:.....|.|||..||...|....|
  Rat    94 PHFSTVKQIIMYSSAPGPPGSSG-----DIALVQLATPVALSSQVQPVCLPEASADFHPGMQCWV 153

  Fly   163 SGWGNTQSAQETSAV--LRSVTVPKVSQTQCTEAY--GNFGSITDRMLCAGLPEGGKDACQGDSG 223
            :|||.||..:.....  |:...|..|....|::||  .|...|...||||.   |..||||.|||
  Rat   154 TGWGYTQEGEPLKPPYNLQEAKVSVVDVETCSQAYSSSNGSLIQSDMLCAW---GPGDACQDDSG 215

  Fly   224 GPLAAD-GVLW---GVVSWGYGCARPNYPGVYSRVSAVRDWI 261
            |||... ..:|   ||||||.||.||:.||||:||:|..:||
  Rat   216 GPLVCRVAGIWQQAGVVSWGEGCGRPDRPGVYARVTAYVNWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 88/235 (37%)
Tryp_SPc 42..264 CDD:238113 89/236 (38%)
Tpsg1NP_783183.1 Tryp_SPc 29..257 CDD:214473 88/235 (37%)
Tryp_SPc 30..260 CDD:238113 89/236 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.