DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Elane

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001100237.1 Gene:Elane / 299606 RGDID:1307968 Length:271 Species:Rattus norvegicus


Alignment Length:247 Identity:73/247 - (29%)
Similarity:117/247 - (47%) Gaps:18/247 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQ-RSYHFCGGSLIAQGWVLTAAHCTEGSA 87
            |.::.|...:..|.|...||||:.|.....|:.|||| |..||||.:|||:.:|::||||..|..
  Rat    15 LASMLLALLLVCPALASEIVGGRPAQPHAWPFMVSLQRRGGHFCGATLIARNFVMSAAHCVNGRN 79

  Fly    88 ILLSKVRIGS---SRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPE 149
            ....:|.:|:   .|.....|:..::|:..: .||...:..|..:::|...:..|.......||.
  Rat    80 FQSVQVVLGAHDLRRREPTRQIFSVQRIFEN-GFDPSRLLNDIVIIQLNGSATINANVQVAELPA 143

  Fly   150 QDADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGG 214
            |...:.:.||.:..|||...:.:...:||:.:.|..|:.. |.....         :|..:|...
  Rat   144 QGQGVGNRTPCVAMGWGRLGTNRPLPSVLQELNVTVVTNL-CRRRVN---------VCTLVPRRQ 198

  Fly   215 KDACQGDSGGPLAADGVLWGVVSW--GYGCARPNYPGVYSRVSAVRDWISSV 264
            ...|.|||||||..:.::.|:.|:  | ||....||..::.|:...|||:|:
  Rat   199 AGICFGDSGGPLVCNNLVQGIDSFIRG-GCGSGFYPDAFAPVAEFADWINSI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 66/225 (29%)
Tryp_SPc 42..264 CDD:238113 68/227 (30%)
ElaneNP_001100237.1 Tryp_SPc 32..246 CDD:214473 66/225 (29%)
Tryp_SPc 33..249 CDD:238113 68/227 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.