DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Klk1c3

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001258244.1 Gene:Klk1c3 / 292872 RGDID:735032 Length:255 Species:Rattus norvegicus


Alignment Length:257 Identity:94/257 - (36%)
Similarity:132/257 - (51%) Gaps:25/257 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ILLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQRSYHFCGGSLIAQGWVLTAAHCTEGS 86
            ||.:.||||.....|....|:|||........|:||::... ..|||.||...||:|||||...:
  Rat     5 ILFLALSLGQIDAAPPGQSRVVGGFKCEKNSQPWQVAVINE-DLCGGVLIDPSWVITAAHCYSDN 68

  Fly    87 AILLSKVRIGSSRTSVGGQLVGIKRVHRHPKFDAYTI--------DF--DFSLLELEEYSAKNVT 141
            ..:|    :|.:..|...|...:.:..|||.:..:.:        |:  |..||.|.|  ..::|
  Rat    69 YHVL----LGQNNLSEDVQHRLVSQSFRHPDYKPFLMRNHTRKPKDYSNDLMLLHLSE--PADIT 127

  Fly   142 QA--FVGLPEQDADIADGTPVLVSGWGNTQSAQ-ETSAVLRSVTVPKVSQTQCTEAYGNFGSITD 203
            ..  .:.||.::..:  |:..||||||:|..:: |....|:.|.:..:|..:|.:||..  .:||
  Rat   128 DGVKVIDLPTKEPKV--GSTCLVSGWGSTNPSEWEFPDDLQCVNIHLLSNEKCIKAYKE--KVTD 188

  Fly   204 RMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWG-YGCARPNYPGVYSRVSAVRDWISSV 264
            .|||||..|||||.|:|||||||..||||.|:.||| ..|..||.||:|:::.....||..|
  Rat   189 LMLCAGELEGGKDTCRGDSGGPLICDGVLQGITSWGSVPCGEPNKPGIYTKLIKFTSWIKEV 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 84/233 (36%)
Tryp_SPc 42..264 CDD:238113 85/235 (36%)
Klk1c3NP_001258244.1 Tryp_SPc 24..247 CDD:214473 84/233 (36%)
Tryp_SPc 25..250 CDD:238113 85/235 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.