DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Klk9

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001099723.1 Gene:Klk9 / 292851 RGDID:1308280 Length:258 Species:Rattus norvegicus


Alignment Length:265 Identity:88/265 - (33%)
Similarity:124/265 - (46%) Gaps:44/265 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GILLVNLSL-----GATVRRPRLDGRIVGGQVANIKDIPYQVSL-QRSYHFCGGSLIAQGWVLTA 79
            |:.||..||     ||       |.|.||.:.......|:|..| ..:...||.:||...|:|||
  Rat     4 GLTLVLFSLLAGHCGA-------DTRAVGARECQRNSQPWQAGLFYLTRQLCGATLINDQWLLTA 61

  Fly    80 AHCTEGSAILLSKVRIGSS---RTSVGGQLVGIKRVHRHPKFD----AYTIDFDFSLLELEE--- 134
            |||.:.    ...||:|..   :.....:|:.:.....||.|:    |...:.|..|:.|..   
  Rat    62 AHCRKP----YLWVRLGEHHLWQWEGPEKLLLVTDFFPHPGFNPDLSANDHNDDIMLIRLPRKVR 122

  Fly   135 ----YSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQ-ETSAVLRSVTVPKVSQTQCTEA 194
                ....|::|:   ||      :.||..|:||||:..|:: :....|:...:..:....|..|
  Rat   123 LSPAVQPLNLSQS---LP------SVGTQCLISGWGSVSSSKIQFPMTLQCANISILDNKLCRWA 178

  Fly   195 YGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWG-YGCARPNYPGVYSRVSAVR 258
            |.  |.|:::||||||.|||:.:|||||||||...|.|.|:||.| ..|:||..|.||:.|....
  Rat   179 YP--GHISEKMLCAGLWEGGRGSCQGDSGGPLVCKGTLAGIVSGGSEPCSRPQRPAVYTSVFHYL 241

  Fly   259 DWISS 263
            |||.:
  Rat   242 DWIEN 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 78/236 (33%)
Tryp_SPc 42..264 CDD:238113 79/239 (33%)
Klk9NP_001099723.1 Tryp_SPc 24..247 CDD:238113 79/238 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8983
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.