DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Tpsb2

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_062053.2 Gene:Tpsb2 / 29268 RGDID:3065 Length:274 Species:Rattus norvegicus


Alignment Length:245 Identity:97/245 - (39%)
Similarity:124/245 - (50%) Gaps:33/245 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IVGGQVANIKDIPYQVSLQRSY----HFCGGSLIAQGWVLTAAHCTEGSAIL---LSKVRIGSSR 99
            ||||:.|:....|:||||:..:    ||||||||...||||||||. |..|.   |.:|::....
  Rat    30 IVGGREASESKWPWQVSLRFKFSFWMHFCGGSLIHPQWVLTAAHCV-GLHIKSPELFRVQLREQY 93

  Fly   100 TSVGGQLVGIKRVHRHPKFDAYTID--FDFSLLELEEYSAKNVTQAF--VGLPEQDADIADGTPV 160
            .....||:.:.|...||.:  ||::  .|.:|||||  :..||:...  ..||........||..
  Rat    94 LYYADQLLTVNRTVVHPHY--YTVEDGADIALLELE--NPVNVSTHIHPTSLPPASETFPSGTSC 154

  Fly   161 LVSGWGNTQSAQE--TSAVLRSVTVPKVSQTQCTEAY-------GNFGSITDRMLCAGLPEGGKD 216
            .|:|||:..|.:.  ....|:.|.||.|..:.|...|       .:...:.|.|||||  ....|
  Rat   155 WVTGWGDIDSDEPLLPPYPLKQVKVPIVENSLCDRKYHTGLYTGDDVPIVQDGMLCAG--NTRSD 217

  Fly   217 ACQGDSGGPLA--ADGVLW---GVVSWGYGCARPNYPGVYSRVSAVRDWI 261
            :|||||||||.  ..|. |   ||||||.|||..|.||:|:||:...|||
  Rat   218 SCQGDSGGPLVCKVKGT-WLQAGVVSWGEGCAEANRPGIYTRVTYYLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 95/243 (39%)
Tryp_SPc 42..264 CDD:238113 97/245 (40%)
Tpsb2NP_062053.2 Tryp_SPc 30..268 CDD:238113 97/245 (40%)
Tryp_SPc 30..266 CDD:214473 95/243 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.