DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Gzmk

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_058815.1 Gene:Gzmk / 29165 RGDID:68401 Length:258 Species:Rattus norvegicus


Alignment Length:256 Identity:91/256 - (35%)
Similarity:121/256 - (47%) Gaps:29/256 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQ-RSYHFCGGSLIAQGWVLTAAHCTEGSA 87
            ||.|..|..:........|:||:.......|:..|:| |..|.|||.||...||||||||...  
  Rat     8 LVFLVAGIYMSSESFHTEIIGGREVQPHSRPFMASIQYRGKHICGGVLIHPQWVLTAAHCYSR-- 70

  Fly    88 ILLSKVRIGSSRTSVGG-----------QLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVT 141
                    |.|.|.|.|           |...||.......|.:.|  .|..|::|...:..|..
  Rat    71 --------GHSPTVVLGAHSLSKNEPMKQTFEIKEFIPFSGFKSGT--NDIMLIKLRTAAELNKH 125

  Fly   142 QAFVGLPEQDADIADGTPVLVSGWGNTQ-SAQETSAVLRSVTVPKVSQTQC-TEAYGNFGS-ITD 203
            ...:.|..::. |.|||...|:|||:|: ....||..|:.|||..:|:.:| :::|.|... ||.
  Rat   126 VQLLHLRSKNY-IRDGTKCQVTGWGSTKPDVLTTSDTLQEVTVTIISRKRCNSQSYYNHKPVITK 189

  Fly   204 RMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVS-AVRDWISS 263
            .|:|||...|.||:|:|||||||...||...:||.||.|...|.||||:.:: ..:.||.|
  Rat   190 DMICAGDRRGEKDSCKGDSGGPLICKGVFHALVSGGYKCGISNKPGVYTLLTKKYQTWIKS 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 84/235 (36%)
Tryp_SPc 42..264 CDD:238113 87/238 (37%)
GzmkNP_058815.1 Tryp_SPc 25..248 CDD:214473 84/235 (36%)
Tryp_SPc 26..251 CDD:238113 87/238 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.